Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
$0.00
Necklaces
Necklaces
Flower of Life Jewelry Set — Stainless Steel Necklace, Bra..
Flower of Life Jewelry Set — Stainless Steel Necklace, Bra..
$30.00
Flower of Life Necklace — Stainless Steel Sacred Geometry ..
Flower of Life Necklace — Stainless Steel Sacred Geometry ..
$15.00
Metatron’s Cube Necklace — Stainless Steel Sacred Geometry..
Metatron’s Cube Necklace — Stainless Steel Sacred Geometry..
$20.00
Metatron’s Cube Necklace — Stainless Steel Sacred Geometry..
Metatron’s Cube Necklace — Stainless Steel Sacred Geometry..
$15.00
Stainless steel tarnish tarot necklace
Stainless steel tarnish tarot necklace
$20.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i